SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI64590 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI64590
Domain Number - Region: 246-284
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00968
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI64590
Sequence length 374
Comment (Physcomitrella patens)
Sequence
MQQQQSNDRKEALATKALQAVVNKIDQFDGRNISRYLRCYVREMELNRISEKKMVALFGL
AMILEIRDHITSITDRYGNSWEDFSHALKDEYFLEDVDRVTKKLFLGWIERPNKNLQAIE
LLREFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQEKLEPLLKDKEEDEGLTTKRKDR
SNIPKTVQAPQAPVHITPPTMPTVQPSTSLSKKADMGMEEIIRGMRDLQIKLARLEENTS
INNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQEIICWKDGKIALKDREDLLQTN
FGKGRMRALVQDYLKEHETVARESASYGARVDDEIGGSTETSEFWASAVSTMQEGKLPRE
ALLRTAATIRGRTG
Download sequence
Identical sequences A9RDD6
3218.JGI64590 XP_001752107.1.60028 jgi|Phypa1_1|64590|fgenesh1_pg.scaffold_3000042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]