SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI64955 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI64955
Domain Number - Region: 184-220
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000837
Family Retrovirus zinc finger-like domains 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI64955
Sequence length 570
Comment (Physcomitrella patens)
Sequence
MILGEVVELYYGRVADILNKWSNHQMSEVFILSILINGLYPPELKIFVKEAQTVTVAASL
NRAKIWDECHYDQFLTTRATMISVQGRYQNPTWNESMGSYPRMLEIRANSNTNIEGPVNV
TPLQAIPPNVTKTYAPYFPYQQQVLTTIEIPIMPPLKDSNKTLLLNLTKKMEEMAVNMAK
DKKKRQKPTNTRTNVWCSNCKGYDHSITECPSPSQIMDQYTFCGRKHLTANCWNWQRQQQ
QFSNQTMIPPIQWDLNQFQGTSYPLKDPLEDKNFKEAPAAVLISSPGRKNILPHGVKLKP
MKRKRTLRIILNMKPYDILKDLDAIWPSISMKQLLAVTSECRFTLNSSLTQHRHRNKEVC
EVSLNHDRGAPNIDVLLDSVMISGVQVDGGSSVNLMNVDTMEDLDLKQLLPTTLVLRMAD
HSRLYEAKAKNNWGRGTLTIRKGHDQIVLQMYPVQYHGKSQLPESEFTSDNESQLIKGLD
EYLLHQEDATNLDHAITEWMNNPTVNRVSTLEPDLGGLHMSDNTRYSDQKKTIKSQIVED
PLCQSINLGTNETPQLIKIYVDIIGTELDA
Download sequence
Identical sequences A9RE88
jgi|Phypa1_1|64955|fgenesh1_pg.scaffold_4000070 XP_001752394.1.60028 3218.JGI64955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]