SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI64957 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI64957
Domain Number 1 Region: 448-497
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000209
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 
Domain Number 2 Region: 300-343
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000628
Family Retrovirus zinc finger-like domains 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI64957
Sequence length 939
Comment (Physcomitrella patens)
Sequence
MRPTIEIGRKECKPYCGRRDSSSLIVKSVKRFIKKRIFTKEFGSLFQGALLPNKFKQLEL
PAEVLSSPVEEIIKDIERITESETITLPILPPIVLLPMASRGVPSVPTGPPVPPIGPIGP
AVPISVPMGQVGDRTISIAPLPIFSGWPGADPDQHLSQFLTACIASNGRTEDVWLRWLRA
TLKDTAFEWYNRQPAGSSKFPNWSNLANSITGAMAPATYSTVPIQGVLNPVPLQAVPSPM
ASTYPQFAPYQPPGFNTQELPMLPGSKETNETLLLNLTKKMEELAVYMAKEKEKRPKQTN
FRANLWCTNCKGQGHMVQDCPSPGNMKIQCMNCGGKHLTNNCWYLSNPHFNNTMSPPMSW
DVNQIQGSNGNGWNGNRFNNQNCNYSNNQNFGPNSQKFHPNQRNYQENNGFMPEPSLQTG
QPGSFTQATWNIPSRYIPIETSNIPSGMGRKPVRCFRCRQYRHYANECSNSSASKEYAPI
CGNCKQSGHTTAQCNAPFNFNNRNQQVQIQSSQEDINPVLQDSPVNHIEVVQAVQTRGQR
NLQSILKKDKIIEEQPEPIQKKATIFAKPANQLRPVLVPTDSFNSTLIAPAGVNFQCPIQ
SIPIETVPTLSRIPISAPIEPPNSISQSNKVSISNPIQSMLISKKLKFPKTRRKKAFGIT
IDLTPYDILKDLDEIQPAITMKQLLAIAPECHSTLTSSLIRRRHRDKEIHEVSLNLDPGA
PTIDVTIDGVLISSVQVDSVHPMGVLVDVETIIAEIAYKIDYVVFQLKSSALSYPILLVR
PWLFHAKAHNDWGRRTLTIEKKCNKIVLQMYPVSYHGESQVPCTKFTSEGHSESSDDEDP
FHGNEQYEQIQSLTKHTGVIYQCGGPGEYLIHQEDTDNSDHAIARWMNNYAVNHISAMEP
EMDGANSPELVMGSEPNKQLEAPVLVEPVCQEINLGLET
Download sequence
Identical sequences A9RE89
XP_001752395.1.60028 jgi|Phypa1_1|64957|fgenesh1_pg.scaffold_4000072 3218.JGI64957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]