SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI64958 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI64958
Domain Number - Region: 354-392
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0201
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI64958
Sequence length 700
Comment (Physcomitrella patens)
Sequence
MWFRLRGLILFEAVLFSVPFQETLFTVNGFLKGKNGGESLTARANFGSKLESFIFQQSKT
DRLLDYQRISILPSTARRPDFWEKFLVGSLLKDKQQQSNDQKEALATKALQAVVNEIDQF
DGRNISRYLRCYVREMELNRVFEKKMVALFGLATIPEIRDHITSITDRCGNSWEDFSHTL
KDEYFLEDADRVTKKLFLGWIERPNKNLQATELLREFERQYSQLSKVEKLTLEPNKVDLF
LQAADGELQEKLEPLLEDKKEDEGLTTKWKNVEDAVGLLTKKERRKDRSNIPKTVQAPKA
PIHTTPPTMPTVQPSTSLSKKADMGMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGY
VQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDGKIALKDREDLLQTNFGKGHETVARES
ASYGARVDDEIGGSTKTSEFWASAVSTMQEGKLPREALLRTAATIRGRTGWEDPVESLSV
HAYIAKIQHEALMEEKRRGNFDDTRERNSFKKQTRGDKAWEAASQELPIKDTSASLGEKT
TETKDKGKSIADKLLSDIEAATNLKGVLEERILNAKVEFTLKEVLEIAKKEFHDVIIDSI
KRKRQLMSETGMSHAIDARICRDEEERVRFEDSSDKEMETLSHYTRKHWARATTEVLVKV
GDIEEPIVALVDHGSEINLMSKDLYKKQKWPIDMEHGWAI
Download sequence
Identical sequences A9RE90
jgi|Phypa1_1|64958|fgenesh1_pg.scaffold_4000073 3218.JGI64958 XP_001752396.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]