SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI65104 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI65104
Domain Number 1 Region: 324-371
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000119
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI65104
Sequence length 395
Comment (Physcomitrella patens)
Sequence
MDAKDDQMTSVAPLPTFWGFPSVDPDQHLSQFLIACVANNGRTEDIWLRRLRMVSREAVQ
SYYGRVVDILRKWPNNQMLESFVLSILVNGLYPPELKMFVKKAQSATIASSLERAKVWEE
CHYDQNLTTGATMIPSQGGYQMTNWNDASGIYLGRNDYGTIPRGIVDAVPLQAIPPSSSH
PYVPYSAYQKSIPTKELPNALHITTNCWNLWKQQLSNQIMTQSTSWDVNQVQTNNRFGWN
RNRANKQNRNYSNFFNSEFHQEGVSNTHGLAMNQPGYHQYPSMTKPMPDSIVIKDQPGSF
THPTWNRPSRYIPVEIPIIPEGVGRRPLRCYRCRQIGHYANECPNPRTNDDYALICRNYK
QSDHTYQQCNASFNYNNWDQQMQTSQPTKDKGPIQ
Download sequence
Identical sequences A9REK8
jgi|Phypa1_1|65104|fgenesh1_pg.scaffold_4000219 XP_001752453.1.60028 3218.JGI65104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]