SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI65959 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI65959
Domain Number - Region: 519-617
Classification Level Classification E-value
Superfamily Acid proteases 0.000571
Family Retroviral protease (retropepsin) 0.041
Further Details:      
 
Domain Number - Region: 219-257
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0215
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI65959
Sequence length 737
Comment (Physcomitrella patens)
Sequence
MELNRVSEKKMVALFGLAMIAEIRDHITSITDRCGNSWEDFSHALKDEYFLEDADCVTKK
LFLGWIERPNKNLQATELLREFERQYSQLSKVEKLTLEPNKVDLFLQATDGELQEKLESL
LEDKKEDEGLTTKWKNVEDAVGLLTKKERRKDRSNILKTIQAPKAPVRTTPLTMPTVQPS
TSLSKKADMGMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRK
DCNEFNNMIRQGIICWKDGKIALKDREDLLQTNFGKGGMRALIQVYLKEHETVVRESASY
GTRVDDEIGGSTKTSEFWASAVSTMQEGKLPREALLRTAATIRGRTGWEDPVESLSVHAY
IAKSQHEALMEEKRRGNFDDTREGNSFKRQTRGDKAREAASQELPVKDTSASLGEKTKET
KDKGKSITYKLLSDIEAATNFERGVGRIIKQQRQLMGETGMSHAIDARIYRDEEEVDIGY
KQPTNEKNGYNQRVHFEDSSDKEMETLSHYTRKHWARATIEVLVKVGDIEEPIVALVDHG
SEINLMSKDLYKKQKWPIDMEHGWTIRAANNTRGELYGASPDVKIRIGDVATEQHFFVQD
TTSYPLILGQPYITATRMETKVLDDGSAYARIRSEDGRKAVQFLTVPPNHERNQDRLREK
PLPKIVEGFKDFGEFTEETLEKLKIGSDGSLLSEEITCFKKMLAKQGRSFAFESHEIGCV
DPNIITLMVIFTVPHVP
Download sequence
Identical sequences A9RGW7
jgi|Phypa1_1|65959|fgenesh1_pg.scaffold_8000161 XP_001753285.1.60028 3218.JGI65959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]