SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI66060 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI66060
Domain Number 1 Region: 80-166
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000101
Family Eukaryotic type KH-domain (KH-domain type I) 0.00088
Further Details:      
 
Domain Number 2 Region: 168-214
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000712
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI66060
Sequence length 678
Comment (Physcomitrella patens)
Sequence
MPGIGGTSFEQTRAEQIATQLDSSFWDIEALDGPRSPSPPPIYDSNGQRTNTRECMKLNP
LYKPPVGYKPVYKEAKLFIPETGTKIAIRGRGAVKEGKRLISGRRDKDLESVHDDLHVHI
TADCFEKVDAAVALIEPLLTPVDEIQNMHKRKQLRELAEMNGTMRDFPKICSICGEVGHQ
EWQCSKEALITFQSKVACSICGNGGHPSIDCLQKTSKPGTTQGQTLDTEYMNFLKELNNG
SLGFVTNVSNSSTTTNTSVPGLASTDAPQNSNEIQSIHKQFLMPNSATASPPQLLPPTML
NRPQVVYIRSPPVWGGACYNGGLQPRGPPTKLIRIANGGCVQQRPMCMAPIQNGPCGATP
RNDTKNPNNSSQPPQLETPITYVSNPSLTIGSNQNGPLVPYNSVKMVGSPNLVAIHPHQM
MRPIYQTTMHAPTNPPSQSMEGQPFQIIHGPPPKGMMNSLNVVHAQIVRPHQTNDYRILQ
RPLLYQPPLHGAFKPNSLQTPICASPQSVAPNMGTLQQFPDLSTSQMPPQSWQPVNSNNT
QLWPINQNKAPPLPPTFHSGSSLIDSPTPKSSIKLVSQVSTIPNPSSTQNLVSTIKSTSH
DIQYQPPNTAHHPSNEESASIPNAMPHDPILNSSRQTFTQQLNSSCFPQPPSSSMHTQSI
DFENEKLMASVETTQIQS
Download sequence
Identical sequences 3218.JGI66060 jgi|Phypa1_1|66060|fgenesh1_pg.scaffold_9000097 XP_001753520.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]