SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI66144 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI66144
Domain Number - Region: 465-561
Classification Level Classification E-value
Superfamily Acid proteases 0.000788
Family Retroviral protease (retropepsin) 0.036
Further Details:      
 
Domain Number - Region: 199-238
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0251
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI66144
Sequence length 621
Comment (Physcomitrella patens)
Sequence
MVYSYYNTTTTPSEPVHPPDFSHALKDEYFLEDTDRVTKKLFLGCIERPNKNLQATELLK
EFERQYSQLSKVEKLTLELNKVDLFLQAADGELQEKLEPLLEDKEEDEGLTTKWKNVEDA
VELLTKKERRKDRSNILKTVQAPKAPVRTTPPTMPTVQPSTTLSKKADMGMEEIIRGMRD
LQIKLARLEENTSINNSKNVSKQRYVQRCIWCDDASHSRKDCNEFNNMIRQGIICWKDGK
IALKDREDLLQTNFGKGGMRALVQDYLKEHETVVRESASYGARVDDEIGGSTGTSEFWAS
AVSTMQERKLPREALLRTAATIRGRTASLGEKTTETKAKGKSIAYKLLSDIEAATNLKGV
LEERILNAKVEFTLKEVLEIVKKEFHDVIIDSIKRKRQLMSETRMSHAIDARICRDEEEV
DIGYKQPTNEKNGYNHRVCFEDSSDKEMETLSHYTRKHWARATTEVLVKIGDIEEPIVAL
VDHGSELNLMSKDLYKKQKWPIDMEHGWAIRAANNTRGELYGAYPDVKIWIGNVATEQHF
FVQDTTSYPLILGQPYITATRMETKVLDDGSAYARIRSEDGRKAVQFLTVPPNHERNRDR
LREKPLPKIVEGFKDFGEVPL
Download sequence
Identical sequences jgi|Phypa1_1|66144|fgenesh1_pg.scaffold_9000181 XP_001753433.1.60028 3218.JGI66144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]