SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI66318 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI66318
Domain Number - Region: 184-221
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0251
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI66318
Sequence length 665
Comment (Physcomitrella patens)
Sequence
MGIVFLHALKDKYFLEDADCVTKKLFLEWIERPNKNLQATELLRKFERQYSQLSKVEKLT
LEPNKVDLFLQAANGELQGKLELLLEDKEEDEGLTTKWKNIEDVVELLTKRERRKDRSNI
PKTVQAPKAPVRTTPPTMPTVQPSTSLSKKANMGMKEIIRGMRDLQIKLARLEENTSTNN
SKNVAKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDGKITLKNREDLLQTNFGK
GRMRALVQDYLKEHETTTRENASYGARVDDEISGSTKTSEFWASAEIYLYIYSILINLMS
KDLYKKEKWPIDMEHGWAIRAANNTRGELYGACPDVKIWIGDIATEQHFFVQDTTSYLLI
LRQPYITATRMETKVLDDGSAYARRDYGGTKEEVLSRDEGAFDASFIGILENGNIMYKKV
DDFKRKEKKRLYDIEGQLCKLGTLQDDERILGVYEENGLEDLLELITSIELGDKDKIVEI
HSREVYTILESFQAPEVTVETRYKMADKKVKPVARPLPEDSKEQMGEASKEASLRDPMSI
GHQFIKETFEELKIGSDGSLLPEEITCFKKMLAKQGRSFAFESHEIGCEDPNIVTPMVIF
TVPHATQCGSEYGVSILFQAVLFSVSFQGTLFLVNGSLKGKNGGKSSDGGSQFRIQDGRL
KKFRG
Download sequence
Identical sequences A9RI69
3218.JGI66318 XP_001753646.1.60028 jgi|Phypa1_1|66318|fgenesh1_pg.scaffold_10000077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]