SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI66411 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI66411
Domain Number - Region: 212-256
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000349
Family Retrovirus zinc finger-like domains 0.0031
Further Details:      
 
Domain Number - Region: 653-746
Classification Level Classification E-value
Superfamily Acid proteases 0.0108
Family Retroviral protease (retropepsin) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI66411
Sequence length 1586
Comment (Physcomitrella patens)
Sequence
MVNKNESIASRKINQLRERQGRAQRRNLRREEQECNLKRKHRQNWIKPWLQACRRIRTYQ
EPDRLLILQSYVPLEKLPRALAGNFVNIPVEILRPLIEREGGIEVFGTPLGNYIVFQNPT
FSPASQPTKLFAENNSKARTAESSVIKAVLPSSPQPYVPYFAYQKSIPTKELTNELVSRD
PNESLLLTLTKKMDELAVNLAKDKEKRHKPTNIRPNVWCSNCKGQGHLVTECSSPPQMMV
QCTFCGGKHTIANCWNLRKQQQVGQQTMSQPTSWDVNQMQTSQPAEDKGPVQRDSPVHRV
EVVNAVLTRGQQKGKNPIQDLDDPIEVTTVAPSKRQTEPISVLGRIPILSPQQDEKPTSC
SRANFSGTSRSIPNDHVPIPAQPNISSYLEYWEQRPTPVQTLSGQVQSPRYSQSGHTEML
RSIPITGGRKLPREALLRTAATIRGRTGWEDPVESLSVHAYIAKSQHEALMEEKRRGNFD
DTREGNSSKRQTQGDKAWEAASQELPIKDTSASLEEKTKKTKDKSKSIACKLLSDIEAAT
NLKGVLEERILNAKVEFTLKEVLEIIKKKFHDVIIDSIKRKRQLMGKTGISHAIDARIYK
DEEEVDIGYKQPTNEKNGYNQRVHFQDSSDKEMETLSHYTRKYWARVTTEVLVKVGDIEE
PIFALVDHGSEINLMSKDLYKKQKWPIDMEHGWAIRAVNNTRGELYGACPDVKIWIGDVA
TEQHFFVQDTTSYPLILGQSYITATRMETKVLDNGFAYTRGRSEDGRKVVQFLTVPPNHE
RNRDRLREKPLPKIVEGFKDFGEEVLSRDEGAFDASFIGILENGNIMYKKVDDFKRKERK
RLYDIEGQLCKLSTLQDDERILGVYEENGLEDSLELITSIGVGDNDKIVEIHSREVYTVL
ESFQAPEVTVETRYKMADKNVKLAAGPLPEDFKEQMGEASKKASLRDPMSIGHQFIKETF
EELKIGSDGSLLPKEITCFKKMLAKQDRLFDFESHEIECVDPNIVTPMVIFTVPHELASS
FFKVTSSVSLEVFEDHGERSFMLRVGEDGELDFSSSWGFGKTEAIDAEVSVVMSFIFQQS
KTDRLLDYWRISILPSTTRRPARSRVGKHSFIMSREKVKRASEKEEEGRKVRSRSNMDEL
SLCILTNMEPMRLEIYWNATWQKDFRSAQLYPFLRVADNLPSIDVELLEEYLTNYDPEDG
SSVVKGRTLEIDENTLHKALQLSIGELAVGAEEASDFNPGSYFKGGMTLLERNQGWRTAD
ALTPELMEWMRFVQKRLGLNRHTTIHAELSYKGKSGRIATLLCSNYIQSAIVYELSQLLS
EKGKTIAAPVLPKPRSNLLALPWGPGETSQQAGEPMSVPERDPMAQRDNRPQTANELVDH
TNFKQQLVVCKREMAEQCQKLLEQDRVNRATKEANSRLEHVLGVKQKAWEKKRERLHQGM
AHQKQELSNSLNQAKLEVEKMKQQLELNQTKMATLEQEKKTMSDQFRVKTEEIQKEINTL
KEVAKKLEEELVSVRRSQRSIEGSIGELEQKVKQQQYQLEAKDIQILQLESEVRELGALN
EDLTARLNIVPINVSDEEDEEVTLEL
Download sequence
Identical sequences A9RHT3
XP_001753802.1.60028 3218.JGI66411 jgi|Phypa1_1|66411|fgenesh1_pg.scaffold_10000170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]