SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI66413 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI66413
Domain Number - Region: 105-143
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00212
Family Retrovirus zinc finger-like domains 0.008
Further Details:      
 
Domain Number - Region: 14-100
Classification Level Classification E-value
Superfamily LDH C-terminal domain-like 0.0432
Family Lactate & malate dehydrogenases, C-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI66413
Sequence length 151
Comment (Physcomitrella patens)
Sequence
MILVLGSYQNLTWSRSVDSYPRMLEIVANCSANIQGPINVIPLQAILPNVTTTYAPYFLY
EQQATELPIIPVPKDSNEALLLNLTKKMEEMAVNMAKDKEKRHKPTNTMTNVWCNNCKDH
GHLVTKYPSPSQMMDQCTFCRRKYLTANCWN
Download sequence
Identical sequences A9RHT5
XP_001753683.1.60028 jgi|Phypa1_1|66413|fgenesh1_pg.scaffold_10000172 3218.JGI66413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]