SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI66454 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI66454
Domain Number - Region: 554-646
Classification Level Classification E-value
Superfamily Acid proteases 0.000328
Family Retroviral protease (retropepsin) 0.049
Further Details:      
 
Domain Number - Region: 262-292
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0445
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI66454
Sequence length 882
Comment (Physcomitrella patens)
Sequence
MEQQQSNDRKEALATKALQAMVNKINQFDGRNISRYLKCYVREMELNRVSEKKMIELFGL
AMIPEIRDHITSITDRYGNSWEVFSHAFKDKYFLKDTDRVTKKLFLEWIERPNKNLQPTE
LLRKFERQYFQLLKVEKLTLEPNKVDLFLQATDRELQGKLEFLLEDKEEDEGLTTKWKNV
EDAMELLTKREKKKDRSNIPKTVQAPKAPVRTTPPTIPTVQPSTSLSKKADMGMEEIIRG
MRDLQIKLARLEENTSTNNSKNISKQGYVQRCVWCDDTSHTRKDCNEFNNMIRQGIICWK
DRKIILKDREDLLQTNFGKRGMRALIQDYLKEHEIAAQESVSYGARIDDDLGGSTETIHA
YIAKSQHEALMEEKRRGNFDDTREGNSSKRQTRRDKAQEAASQELHVKDTLASLEEKIRE
TKDKGKSIAYKLLSDIEAATNLKGVLEERILNAKVEFTLKEVLGIAKKEFHDVIIDSIKR
KRQLMGEIGMSHAIDARIYKDEEEADIGYKQPTNEKNGYNQRVHFKDYSDKKMETLSYYT
RKHWARATTEVFVKVRDIDEPIVALVDYGSEINLMSKDLYKKQKWPIDMEHRWTIRAANN
TWGKLYGACPDVKIRIGDVAMEQHFFVQDTTSYPLILGQPYITATRMETKVLDDGSAYAR
RDYGGTKEEVLSRDEGAFDVSFIDILENGNIMYKKVDDFKRKERKRLYNIEGELRKLGTL
QDDERILGVYEENRVEDSLELITSIGLGDNDKIVEIHSREVYTILESFQVPKVTIETRYK
TADKKVKLVAGPLLEDSKEQMGEASKEASLRDPMSIGHQFTKETFEELKIGSDGSLLPEE
ITCFKKMLAKQGRSFAFESHEIECVDPNIITPMVIFTVPHVP
Download sequence
Identical sequences A9RHX3
XP_001753704.1.60028 jgi|Phypa1_1|66454|fgenesh1_pg.scaffold_10000213 3218.JGI66454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]