SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI66579 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI66579
Domain Number - Region: 209-232
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0576
Family Retrovirus zinc finger-like domains 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI66579
Sequence length 440
Comment (Physcomitrella patens)
Sequence
MEGGNLDSALSRVGRRASFGGQGMHFDSTSTNMFEVLTLFMQQQEQQPKKDLLAIELLRK
FEKKYSSLSKKERQLLDPSKVELFLQAADGKLQEKLEFMLEDKEEDEGLTTNWERVEDAV
KKMTKREKRKDMGGDQRPLQPSKIKVSSIHPTSLIQPSMATSKKEETGIDEIICGMRDLP
IKFAKIEEKGQPSRISTKQRSRPMEGVVHRCMWCDNIDHLTKECEEFTEALRKEIVVFKD
GPSKRIIRGEKAQQQKNSIHEETIESISTKEREIGKEKAKALAYKLQSDIEAATDLKKVL
EERFLSGKIEFIIGEILGITKRKFYKVIIDTIKRKRQSIGDSMISNIQGTRVMERNEDEE
DEIQNFGDVLRVRFAEKEDVIQASSHYSRSHWARATTENLIKLGNLEEPVVALIDDGSEV
KLMTKELYNKKKWPIDTEHG
Download sequence
Identical sequences A9RIH9
XP_001753977.1.60028 3218.JGI66579 jgi|Phypa1_1|66579|fgenesh1_pg.scaffold_11000098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]