SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI66777 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI66777
Domain Number - Region: 100-202
Classification Level Classification E-value
Superfamily Globin-like 0.0013
Family Globins 0.023
Further Details:      
 
Domain Number - Region: 365-405
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0196
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI66777
Sequence length 822
Comment (Physcomitrella patens)
Sequence
MQSNYGKIQVLLRASANLTRRTNLIQLWEHPGLTTGFLPNMRPKLVERLNVVPIMELRFR
FRLFCPLCHSGNVLSIKRSLKGFLGGVSGGGSSKGQGMHMDPSITSMFQAFSLSMQQQQS
NDRKKALATKVLQAVVNKIDQFDGRNILRYLRCYVHEMELNRVSEKKMVELFGLAMIPEI
RDHITSITDHYGNSWEVFSHALKDEYFLNDADHVTKKLFLEWIEWPNKNLQATELLREFE
RQYSQLSKVEKLTLEANKVDLFLQAVDGELQGKLELLLEDKEEDEGLTTKWKNVEDVVGR
NIPKIVQASKAPIRTTPPTMPTIQPSTSLSKKADMGMEEIMRGMRDLQIKLARLEENTSI
KNLKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIWQGIICWKDGKIALKDRKDLLQTNF
GKGGMRVLIQDYLKERETTAQESASYGARVDDDLGGSTETSEFWASAISTMQEGKLPREA
LLRTVATIRGATGWEDPVESLSVHAYIAKSQHEALMEEKRRGNFDDTREGNSSKRQTRGD
EAREAASQELPVKDTSASLGEKTKETKDKGKSTAYKLLSDIEAATNLKGILEEHILNAKV
EFTLKEVLEIAKKKFHDVIIDSIKRKRQLMGETGMSHAIDARIYRDEEEVDIGYKQPTNE
KNGYNQRVHFEDYSDKEMETLSHYTRKHWARATIEVLVKVGDIEEPIVVLVDHANNTRGE
LYGACPDVKIRIGDVATEQHFFVQDTTSYPMILGQPYITETWMEIKVLDDGSAYARVRSE
DGRKVVQFLTVPPNHERNRDRLREKPLPKFVEGFKDFGEVPL
Download sequence
Identical sequences A9RJ10
jgi|Phypa1_1|66777|fgenesh1_pg.scaffold_12000062 XP_001754172.1.60028 3218.JGI66777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]