SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI66972 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI66972
Domain Number - Region: 137-173
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0126
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI66972
Sequence length 403
Comment (Physcomitrella patens)
Sequence
MFVKEAQSTTIAASLERAKVWEECHYDQHLTVGTTMIPSQGGYQMTNWNDTSESYPGRSD
YGCTTIIVTTACALFCVSKIKFCIPTKELTNELVSRDPNELLLLTLMKKMDELAVNLAKD
IEKKHKLTNMRPNVWYSNCKGQGHLVTECSSPPQMMVQCTFCRGKHTTANCWNLRKQQQV
GQQTMSQPTSWDVNQMQTSQPTEDKGPVQRDSLVHRIEVVNAVFTRDQQKGKNPIQDLDD
PIEVTTVAPSMRRTKPIPVLDHIPILGPQQDEEPNSVSRANFSETSRSIPNDPVSIPAQP
NISSYPLKEPLVVEESTKRKELLPNRVKTKPMKRKRALGRTGQPETESNPVIGTTLSRPT
NSGPILESNGAFQYAPADYNGVTEPDHSVFTLELVDAPNIRGN
Download sequence
Identical sequences A9RJJ6
3218.JGI66972 jgi|Phypa1_1|66972|fgenesh1_pg.scaffold_13000033 XP_001754394.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]