SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI67443 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI67443
Domain Number 1 Region: 116-159
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000497
Family Retrovirus zinc finger-like domains 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI67443
Sequence length 215
Comment (Physcomitrella patens)
Sequence
MAEEAPAVPIAVQMGAIGDRTTSVAPLPTFNGWPGSDPDQHLSKLLTACVANNGKTEDAI
PPVATYPSPMAYQQPEVSMNATINDSNEALLLNLTKKMEELAVHMTKDKEKRHKPSNMRP
NVWCNNCKGQGHFVTECPSPHQKMGQCMYCGGKHNTANCWYLPRQQKMIQPTVWDVNQVQ
TGNTGGWNGNRNNRVNRGFGNFQNPNYSQPYGTNM
Download sequence
Identical sequences A9RKP8
3218.JGI67443 XP_001754719.1.60028 jgi|Phypa1_1|67443|fgenesh1_pg.scaffold_14000231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]