SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI67749 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI67749
Domain Number - Region: 589-681
Classification Level Classification E-value
Superfamily Acid proteases 0.00608
Family Retroviral protease (retropepsin) 0.053
Further Details:      
 
Domain Number - Region: 286-324
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0288
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI67749
Sequence length 928
Comment (Physcomitrella patens)
Sequence
MENENKNFEGGEVSGGESSKGQGMHMDPSIASLFQAFSLSMQQQQSNDRKEALATKALQA
VVNKIDQFDGRNISRYLRCYVREMELNRVSEKKMVALFGLATIPEIRDNITSITDRCGNS
WEDFSHALKDEYFLEDADRVTKKLFLGWIEQLNKNLQATELVREFERQYSQLSKVEKLTL
EPNKVDLFLQAADGELQEKLEPLLEDKEEDEGLTTKWKNVEDAVGLLTKKERRKDRSNIP
KTVQAPKAPFNLRHTCQRKQIIRGMRDLQIKLTRLEENTSINNSKNVSKQGYVQRCIWCD
DASHTRKDCNEFNNMIRQGIICWKDGKIALKDREDLLQTNFGKGGMRALVQDYLKEHETV
VRESASYGARVDDEIGGSTETSEFWASAVSTMQEGKLPREALLRTAATIRGRTGNFDDTR
EGNSFKRQTRGDKAREAASQELPVKDTSASLGEKTTETKDKGKSIAYKLLSDIEAATNLK
GVLEERILNAKVEFTLKEVLGIAKKEFHDVIIDSIKRKRQLMSETGMSHAIDARICRDEE
EVDIGYKQPTNEKNGYNQRVRFEDSSDKEMETLSHYTRKHWARATTEVLVKVGDIEEPIV
ALVDHGSEINLMSKDLYKKQKWPIDVEHGWAIRATNNTRGELYGACPDVKIRIGDVATEQ
HFFVQDIMSYPLILGQPYITATRMETKVLDDGSAYARVRSEDGRKAVQFLTVPPNHERNR
DRLREKPLPKIVEGFKDFGEKVDDFKRKERKRLYDIEGQLRKIGTLQDDERILGVYEENG
LKDSLELITSIGLGDNDKIVEIHSREVYTMLESFQAPEVTVETRYKTADKKVKPIARPLP
EDSKKQMGEASKEASLRDPMSIGHQFTEETFEELKIGSDGSLLPEEITCFKKMLAKQGRS
FAFESHEIGCVDPNIITSMVIFTVPHVP
Download sequence
Identical sequences A9RLK2
jgi|Phypa1_1|67749|fgenesh1_pg.scaffold_15000281 XP_001754995.1.60028 3218.JGI67749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]