SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI67837 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI67837
Domain Number - Region: 362-400
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0138
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI67837
Sequence length 1065
Comment (Physcomitrella patens)
Sequence
MWSRLRGSILFQAVLFSVPFQGTLFSVNRFLKGKNGGESLTARANFGSKLESFIFQQSKT
DRLLDYRRISILPSTAKRPARSRAGKHDFWEKFLVGSLLKDKQQQSNDRKEALATKALQA
VVNIIDQFDGRNISRYLRCYVREMKLNRVSEKKMVALFGLATIPEIKNHITLITDRCGNS
WEDFSHTLKDEYFLEDADRVTKKLFLGWIERPNKNLQATELLREFERQYSQLSKVEKLTL
EPNKVDLFLQAVDGELQEKIEPLLEDKEEDEGLTTKWKNVEDAMGLLTKKERRKDRSNIP
KTVQAPKAPVRITPPPMPTVQPSTSLSKKADMGTEEIIRGMRDLQIKLARLEENTSINNL
KNVSKQGYVQRCIWCDDASHIRKDCNEFNNMIRQGIICWKDGKIALKDREDLFQTNFGKG
GMRALVQDYLKEHETLVRESASYGARVDDEIGGSTETSEFLASAVSTMQEGKLPREALLR
TAATIRGRTGWEDPVESLSVHAYIAKSQHEALIEEKRRGNFDDTREGNSFKRQTRGDKAR
EAASQELPVEFTLKEVLGIAKKEFHDVIIDNIKQKRQLMSETGMSHAIDAKICRDEEEVD
IGYKQLTNEKNGYNQRVRFKDSSDKEMETLSHYTRKHWARATTEVLVKVGDIEEPIVALV
YHGSEINLMSKDLYKKQKWPIDMEHGWTIRAANNTRGELYGACPDVKIQIGDVATEQHFF
VQDTTSYPLILGQPYITATRMETKVLDDGSAYARVRSKDERKAVQFLTVPPNHERNRDKL
REKPLPKIVEGFKDFGELCKIDTLQDDERILGVYEENGLEDSLELITSIGLGDNDKIVEI
HSREVYTMLESFQAPEVTVETRYKTADKKVKPVAGPLPEDSKEQMGEASKEASLRDPMSI
GHQFTEETFEELKIGSDGSLLPEEIICFKKMLAKQGRSFAFESHEIGYLEYWEHRPTPVQ
ILSGQVQSLRYNQPGHTEMLHSIPITGVSRKRRTNSHDVFEEPIGSNFDNPICVLLSNMR
LELAGNVVSINGFLKGKNGGESLTARANFGSKLEVGANSESKTED
Download sequence
Identical sequences jgi|Phypa1_1|67837|fgenesh1_pg.scaffold_16000068 3218.JGI67837 XP_001755045.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]