SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI68107 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI68107
Domain Number - Region: 315-355
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0102
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 95-159
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0432
Family Insect pheromone/odorant-binding proteins 0.015
Further Details:      
 
Domain Number - Region: 152-233
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0863
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI68107
Sequence length 487
Comment (Physcomitrella patens)
Sequence
MWSRLRDSILFQAVLFSVPFQRTLFSVNGFLKGKNGGESLTVRANFGSKLESFIFQQSKT
DRLLDYWRISILPSTARCPQQQSTDRKEALATKALQAVVNKIDQFDGRNLSRYLRCYVRE
MELNRVSEKKMVALFGLAMIPEIRNHITSITDRCGNSWEDFSHALKDEYFLEDADRVTKK
LFLGWIERPNKNLQATELLREFERQYSQLLKKLELLLEDKEEDEGLTTKWKNVEDAVGLL
TKRERRKDRSNITKTVQAPKAPVRTTPPTMPTVQPSTSLSKKTDMGMEEIIRGMRDLQIK
LARLEENTSINNSKNVSKKGYVQRCIWCDDASHTRKDCNEFYNMIWLGIICWKDGKIALK
DREDLLQTNFGKGGMRALVQDYLKEHETAARESASYGARVDDEIRGSTETSEFWASAVST
MQEGKLTREALLRTVATIQGRTGWEDPVESLSVHAYIAKSQHEALMEEKRRGNFDDTREG
NSFKRQT
Download sequence
Identical sequences A9RMJ4
jgi|Phypa1_1|68107|fgenesh1_pg.scaffold_17000095 XP_001755285.1.60028 3218.JGI68107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]