SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI68111 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI68111
Domain Number - Region: 411-503
Classification Level Classification E-value
Superfamily Acid proteases 0.00338
Family Retroviral protease (retropepsin) 0.046
Further Details:      
 
Domain Number - Region: 197-237
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0173
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI68111
Sequence length 653
Comment (Physcomitrella patens)
Sequence
MVALFGLATIPEIRDHITSITDRCGNSWEDFSHALKDEYFLEDADHVTKKLFLGWIERPN
KNLQATELLRKFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQEKLEPLLEDKEEDEGL
TTKKKERRKDRSNIPKPVQAPKAPVRTTPSIMPTVQPSTSLSKKADMGMEEIIRGMRDLQ
IKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIWQGIICWKDGKIA
LKDREDLLQTNFGKGGMRALVQDYLKEHETAARESVSYGARVDDAIGGSTETSEFWASAV
STMQEGKLTREALLRTAATIQGRTEKEILLRGKLEETRLREAASQESFMMLSLTALSERD
EEEVDIGYKQPTNEKNGYNQRVRFEDSSDKEMETLSHYTRKHWARATTEVLVKVGDIEEP
IVALVDHGSEINLMSKDLYKKQKWPIDMEHGWAIRATNNTRGELYGASPDVKIRIGDVET
EQHFFVQDTTSYPLILGEPYITATRMETKVLDDGSAYAGIRSEDGRKAVQFLTVPPNHER
NRDRLREKPLPKIRDYRGTKEEVLSRDEGAFDASFIGILENGNIMYKKVDDFKRKERKRL
YDIEGQLHKIGTFQDDERILGGYEENGLEDSLELITSIGLGDNDKIVEIHSRV
Download sequence
Identical sequences A9RMJ8
XP_001755289.1.60028 jgi|Phypa1_1|68111|fgenesh1_pg.scaffold_17000099 3218.JGI68111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]