SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI68113 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI68113
Domain Number 1 Region: 139-172
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000132
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI68113
Sequence length 599
Comment (Physcomitrella patens)
Sequence
MFVKEAQPVTISASLDRAKVWEECHYDQFLTACATMIPVQSNYQYPALNGSVGSYPQMIE
TVAQSSVNTQGPVNVTPLQALPPQVTTAYAPYFPYQTHESTLAEKQIISASKDSNEALLL
NLTKKMEEMAVNMAKDKEKRQKPTNTRTNVWCSNCQGHGHLVTECPSPSQIQSPGKMEGI
NRGPQDSPVNRVECVHTVLTRSQQKGKGPIKHLEDPKAKGQSHPITDQSHSGPETGKVLS
PDLVAKPNEVPITESSVPSRTGLFPPQFQEASYPLKDPLGKGSPKEAQSVVPIPSPGQQN
NLPHGNHNVADVIHEIGESSRTVVQGVAPVIEARRVPSGLAVEEENQVPLLIDINQLAFP
EGRFPEGVSLKNAHWMSKTEVNGIGRTVKKGYRIKIKKIREQELRIQEIEEVKLVLERKL
VLQYEAWTKEKEQISRIVEGQRDELIQNRKSWDLEREKFKCQLQAEVDKTELLATEKALL
CDQLRCETGKMRSEIEVLHNEVSKLTEELTVRSQSQVSIEDVPEGMSPHQHQLELRDAQI
LKLEAQVQELGEYNEDLSVQLRKESLEILEEDEDVPLEPESVEPIMDNVVIDQLDISNK
Download sequence
Identical sequences A9RMK0
XP_001755291.1.60028 jgi|Phypa1_1|68113|fgenesh1_pg.scaffold_17000101 3218.JGI68113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]