SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI68118 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI68118
Domain Number - Region: 294-332
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00331
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI68118
Sequence length 366
Comment (Physcomitrella patens)
Sequence
MAQRTGQPETESNPVIGTTLSRPTNSGPILESNGAFQYAPADCNGVTEPHHSVFVLELVD
APNIQDLWEEFLMGVQLKDKVFEKKMVELFGLATIPEIRDHITSIMDRYGNSWEVFSHAL
KDEYFLEDTDRVTKKLFLGWIERPNKNLQATELLREFERQYSQLSKVEKLTLEPNKVDLF
LQAANGELQGKLELLLEDKEEDEGLTTKWKNIEDAMELLRKRERRKDRSNILKTVQASKA
PVRTTPPTMPTVQPLTSLSKKADMGMEEIIRGMRDLQIKLAKLEENTSTKNSKNVSKQGY
VQRCIWCDDASHIRKDCNEFNNMIREGIICWKDGKIALKDREDLLQTNFGKGEMRALVQD
YLKEHE
Download sequence
Identical sequences A9RMK5
3218.JGI68118 jgi|Phypa1_1|68118|fgenesh1_pg.scaffold_17000106 XP_001755403.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]