SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI68141 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI68141
Domain Number - Region: 564-656
Classification Level Classification E-value
Superfamily Acid proteases 0.0114
Family Retroviral protease (retropepsin) 0.046
Further Details:      
 
Domain Number - Region: 253-285
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0654
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI68141
Sequence length 830
Comment (Physcomitrella patens)
Sequence
MENENKNFEGFLGGVSGGDSSKGQGMHMDPSIASMFQAFSLSMQQQQSSDRKEALATKAL
QEVVNKINQFDGRNISRYLRCYVREMELNRVSEKKMVELFGLATIPEIRNHITSITDRYG
NSWEVFSHALKNEYFLEDADRVTKKLFLEWIERPNKNLQATELLREFRRQYSQLSKVEKL
TLEPNKVDLFLQVADGELQEKLEPLLEDKEEDEGLTTKWKNVEDAVELLTKKRKGGRIGV
IFRKQYKHPKLQYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDGKIALKDREDLLQT
NFGKRGMRALVQDYLKEHETAARESASYGARVDDEIGGSTETSEFWASAVSTMQEGKLPR
EALLRTAATIRGRTCCEDAVESLSVHAYIAKSQHEALMEEKRRGNFDDTREGNSSKRQTR
GDKAREETSQELPIKDTSASLGEKTRETKDNGKSIAYKLLSDIEVATNLKGVLEERILNA
KVEFTLKEVLRIAKKEFHDVIIDNIKQKRIYKDEEEVDIGYKQPTNEKNGYNQRVHFEDY
TNKEMETLSHYTRKHWARATTEVLVKVGDIEEPIVTLVDHGSEINLMSKDLYKKQKWPID
MEHGWAIQAANNTRGELYGACPDIKVQIGDVATEQHFFVQDTTSYPLILGQPYITATRME
TKVLDDGSAYARRDYGGTKEEVLSRDEGAFDASFIGILENGNITYKKVDDFKRKERKRLY
DIEGQLYKSGTLQDDERILGVYEENGLEDSLELITSIELGDNDKIVEIHSREIYTMLESF
QAPEVTVETRYKTADKKIKPVAGPLLEDSKEQMGEASKEASLRDPMSIGQ
Download sequence
Identical sequences A9RMM7
jgi|Phypa1_1|68141|fgenesh1_pg.scaffold_17000129 XP_001755299.1.60028 3218.JGI68141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]