SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI68252 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI68252
Domain Number - Region: 195-235
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0128
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 378-484
Classification Level Classification E-value
Superfamily YwmB-like 0.0575
Family YwmB-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI68252
Sequence length 517
Comment (Physcomitrella patens)
Sequence
MENENKNFEGFLGEVSGGESSKGQGMYMDPSIASLFQAFSLSMQQQQSNDRKEALATKAL
QYSQLSKVEKLTLEPNKVDLFVQAADGELQEKLEPLLEDKEEDEGLTTKWKNVEDAVGLL
TKKERRKDKSNIPKTVQAPKAPVRTTPPTMPTVQPSTSLSKKADMGMEEIIRGMRDLQIK
FVRLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIWQGIICWKDGKIALK
DREDLLQTNFGKGGMRALVQDYLKEHETVVRESASYGARVDDEIGGSTETSEFWASAVST
MQEGKLPREALLRTAATIRGRTGWEDPVESLSVHAYIAKSQHEALMEEKRRGNFDDTREG
NSFKRQTRGDKAREAASQELPVKDTSASLGEKTTETKDKGKSIAYKLLSDTEAAKNLKGV
LKERILNAKVEFTLKEVLRIAKKKFHDVIIDSIKRKRQLMSETGMSHAIDARICRDEEEV
DIGYKQPTNEKNGYNQRVRFEGRRYRRTNSCLGGPWF
Download sequence
Identical sequences A9RMY2
XP_001755468.1.60028 3218.JGI68252 jgi|Phypa1_1|68252|fgenesh1_pg.scaffold_17000240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]