SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI68329 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI68329
Domain Number 1 Region: 158-185
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000576
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI68329
Sequence length 219
Comment (Physcomitrella patens)
Sequence
MESEEESTTFGVAARRTLRTTTLLSSDLGTMADRRPSLGIGEVDKLTGADEYYVWITTSV
VTDKSATQREDEGKRVNRKKTSNYQSSTFSKRETIWNGRSTSSFSPSTKTINFEVENVDL
EEHKVMEDYLENVHVDHMDFFLRPSTIQQGVGQIRAVRPQRQCYNCKDIGHSAMSCPKHY
QGNNHSATIVQIRSMVTGQDIHQLRLDLLRFRIRSLVHG
Download sequence
Identical sequences A9RN47
XP_001755501.1.60028 3218.JGI68329 jgi|Phypa1_1|68329|fgenesh1_pg.scaffold_18000075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]