SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI68333 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI68333
Domain Number 1 Region: 162-209
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000288
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI68333
Sequence length 246
Comment (Physcomitrella patens)
Sequence
MTTGGPVVPIAIQMGTVSDRATSVAPLPTFRDFLGADPDQHLSQFLTACVANNGRTEDIC
NYQYPALNGSVDSYPQMIETVAHSSANTQGPVNVTPLQALPPQVTTAYAPYFPYQTQEST
LAKKQVIPASKDSNEALLLNLTKKMEEKAVNMAKDKEKRQKPTNTRTNVWCSNCQGHGHF
VTECLSPSQVLDKCTFCGGQHLTANCWNLQRQQQFSNPTMIPPTPWDVNQVQTRNTFRWH
RNRSNR
Download sequence
Identical sequences A9RN51
jgi|Phypa1_1|68333|fgenesh1_pg.scaffold_18000079 3218.JGI68333 XP_001755504.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]