SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI68351 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI68351
Domain Number 1 Region: 40-66
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000017
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI68351
Sequence length 276
Comment (Physcomitrella patens)
Sequence
MTKPMPDSTVTMGQSGSFTHLTWTRPSCYISVEISIIPEGVDRRPLRCYRCRQIGHYAST
CPNPRASDDYASICGNYKQSVLGRIPILRPQKIEEPNSIPCANLSGPSRSIPTDQVPIPV
QSIKRSYALKEPLVVEKLAKLPMAISIARKELLSNKSSILSYPILLGRLWLYQAKAKNDW
SQGTLTIEKGRDQIVLQMFTAIWSRTKHFNSKGRSLLMWKSRQIFVASKDVTNSDHAIAK
WMNNPAINRVSTLEPDLGGFHMSDNTRYSHQEKIIK
Download sequence
Identical sequences A9RN68
3218.JGI68351 jgi|Phypa1_1|68351|fgenesh1_pg.scaffold_18000097 XP_001755601.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]