SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI68588 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI68588
Domain Number 1 Region: 99-131
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000544
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI68588
Sequence length 240
Comment (Physcomitrella patens)
Sequence
MIPSSGSQQIQLRNVSMDNYLQMATSNVKNVMLQQPINATPLQAIAPIMMTPYFTSPTYQ
QSKLFTNATVKDPNEALLLNPTKKMEELAMNLAKDKEKRHKPSNMRPNVWCNNCKGQGHF
DTECQTPRQIGVQYIFYRRKSIDPKPRKNKRDKSRSSRLSIHRIEVVQAVLTKSQQKKKG
PIQHLDDPEAKDQLNSITRTSNPGPNMGLLLSIRPKSVVHPNEVPITEALILCQAVPFST
Download sequence
Identical sequences A9RNM9
jgi|Phypa1_1|68588|fgenesh1_pg.scaffold_19000121 3218.JGI68588 XP_001755718.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]