SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI68907 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI68907
Domain Number 1 Region: 137-184
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000009
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI68907
Sequence length 192
Comment (Physcomitrella patens)
Sequence
MFVKEAQPNTVTASLNRAKIWEECHYDQFLTTGATMILVQGSYQNPIWNRSMGSYPRMLE
TVTNSSANIQGLVNVTPLQAIPPNVTITYAPYFPYQQVAELPIIPPPKDSNEALLLNLMK
KMEEMVVNMAKDKRHKPTNTKTNVWCSNCKDHGHLVTECPSPSQMIGQCTFCGGKHLTTN
CWNWQRQQQFNN
Download sequence
Identical sequences A9RPR2
jgi|Phypa1_1|68907|fgenesh1_pg.scaffold_21000015 3218.JGI68907 XP_001756055.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]