SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI69048 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI69048
Domain Number - Region: 617-644
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00293
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI69048
Sequence length 1084
Comment (Physcomitrella patens)
Sequence
MQRRRREPRSESARGKNRVEVGGWSEGVWMAVFGEGGRIAVERELGVYEGRARTQKEGTP
SKTKPARKSAAPGQIESRQAPFREERGDRRGFCPHGLGGRRERGSDGEGGRAWADREKAA
VGRRLGGVELGRAQDVRVVMEGALHEDRVGPSRVRIIWCGLRLTVPGWLALQPEAKGWKV
EALPRQKAVSPLAEEEELGDRVWDKMHKATRSQKPVLTPPLGEPNQPRGIPSKLREPLHL
DNQLEFFEDLDNPIGDFIEVILDQSELTHNSTTIYSRKLENPISILSPNQPRSRNLLIPM
ASGGASTGGGGLPGIPINPLVQPRGLPIVVPPGLSIASIPPHLPLFKGTRDEYLSAHVEW
FIEILTTCLITDVRYFLVWFPTTLKEGVYEWYRNHPANTFVDWDMLQRAFLEEFRPEVGQ
NAALTALSSFRQGKDEDITSYIRRFELVVTRFVGTLLTDDTLKNFFIQGFSKETTIREIL
NSRPQTLADAKRAARMIEQINKEHDRIWRNEDQNIPSFIPIHAQGTGSSLNSNQPSIAMP
LHPMQQYPTLLDARLPAALSALTYPEENWREEMKREMQSVQQGFQDQISQQMKLMTDQMA
ALVRIQNFNPPPPPIEFGNHSSGLWCTRCGQPGHTLQFCNENPSQNQQSQGQQSYIPPHR
AQIVQPPNYGQQINQFANQGPNSQYRPRPEYYAFCGNYHMLNPPMKPALAIMTRSRTANM
PSVLEEEESLTESPPHLSELEDIARKTKDAINNRGEEPLEFDPLIGDLPFQLRDHDGEPS
ICHGHNHAYLSELFFHRVLVLDSIKLDTCDWEGPAIPKSELIQPSKTQADLGRIKADITI
AQLLEISPIAKKMLKSETSIKRRRKAKVKVATRVQTSRKPVDTPIPVTTPNIQRQAQMEK
PWTGSEPQLLDTTHHVLGCIGPGLYDWKDDGQFAQWLEDNPHSDLEHTTCYIEASMRELE
DGYPGLATVIDDIIYEDVYHLTMDGTQFEDVDTLLKEEDLLPPLHVRKTNRGLDIGTDLS
IYPPVPSDWYHGSTKLDYVKPSDWKIELLGVVVPEPEFPIDAEALAKLLRIRSKSLDLPL
RDKS
Download sequence
Identical sequences A9RQ41
jgi|Phypa1_1|69048|fgenesh1_pg.scaffold_21000156 XP_001756116.1.60028 3218.JGI69048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]