SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI69120 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI69120
Domain Number - Region: 346-440
Classification Level Classification E-value
Superfamily Acid proteases 0.00326
Family Retroviral protease (retropepsin) 0.048
Further Details:      
 
Domain Number - Region: 46-84
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0128
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 201-303
Classification Level Classification E-value
Superfamily YwmB-like 0.0432
Family YwmB-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI69120
Sequence length 464
Comment (Physcomitrella patens)
Sequence
MPTVQPSTSLSKKADMGMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCD
DASHTRKDCNEFNNMIRQEIICWKDGKIALKDREDLLQTNFGKGGMRALVQDYLKEHETE
ARESASYGARVDDEIGGSMETSEFWASAVSTMQEEKLPREALLRTAATIRGRTSWEDPVE
SLSRQTRGDKAREAASQELPVKDTSASLGEKTTETKDKGKSIAYKLLFDIEAATNLKGLL
EERILNAKVEFTLKEVLEIAKKEFHDVIIDSIKRKRQLMSETGMSHAIDARICRDEEEVD
IGYKQPTNEKNGYNQRVRFEDSSDKGMETLSHYTRKHWARATTEVLVKVGDIEEPIVALM
DHGSEINLMSKDLYKKQKWPIDMEHGWAIRAANNTRGELYGACPDVKIRIGDVATEQHFF
VQDTTSYPLILGQPYITAIRMETKVLDDGSAYARIRSEDGRKAV
Download sequence
Identical sequences A9RPQ4
jgi|Phypa1_1|69120|fgenesh1_pg.scaffold_21000228 3218.JGI69120 XP_001756266.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]