SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI69284 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI69284
Domain Number - Region: 241-281
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0144
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI69284
Sequence length 675
Comment (Physcomitrella patens)
Sequence
MENENKNFEGSLGGASGGGSSKGQGMHIDPSIASMFQAFSLSMQQQQSNNRKKALATKAL
QAVVNKIDQFDGRNISRYLRCYVREMELNRISEKKMVKLFGLTMISEIRDHITLITDRYG
NSWEVFSHALKDKYFLEDADRITKKLFLEWIERPNKNLQATELLREFERERRKDRSNIPK
TVQAPKAPVRTTLPTMPTVQPSTSLSKKADMGMEEIIRGMRDLQIKLARFEENTSTNNLK
NVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDGKIALEDREDLLQTNFGKGG
MRALVQDYLKEHETAVRESASYGARIDDDLGGSTETSEFWASAISTMQEEKLPREALLRI
AATIRVHAYIAKSQHEALMEEKRRGNFNDMREGNFSKRQTRGDKAREAASQELPVKDISA
SLEEKTRKTKGQPYITATRMETKVCDDGSLYAKRDYGGTKEEVLSQDEGAFDVSFIGILE
NGNIMYKKVNDFKRKERKRLYNIEGELCKLGTLQDDERILGVYKENGLEDSLELITSIGL
EDNDKIVEIHSREVYTILESFQAPEVTVETRYKIANKKVKRVAGPLPKDSKKQMIEASKE
ASLRDPMSIGHQFTKETFEELKISSHRSLLLEEITCFKKMLTKQGRSFAFESHEIGCVDP
NTITPMVIFTGPHVP
Download sequence
Identical sequences A9RQI3
3218.JGI69284 XP_001756338.1.60028 jgi|Phypa1_1|69284|fgenesh1_pg.scaffold_22000146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]