SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI69495 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI69495
Domain Number 1 Region: 140-175
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000017
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI69495
Sequence length 469
Comment (Physcomitrella patens)
Sequence
MVIKNENLTVKKIRQSRKRIERSQARNLLQNEQQRKLKRNHRQSWIKPWLHACRHIRAYS
EANRHLIFQKYIPLKKLPRALAENLVNRPGFLLRPLTKSGGITEELSTPLASKDSNEALL
LNLTKKMEEMAVNMAKNKEKRQKSTNTRTNVWCSNCQGYGHLVTECPSPSQVLSKCTFCG
GKHLTANYWNLQRQQQFSNSTMIPPTPWDVNQIQSPRKIEGINRGPQDSLVNLVECVHTI
LTRSQQKGKGQSHLITDPFHSGFDTGKVLSPDLVAKPNEVPITESSVPSRTDLFPPQFQK
ASYPLKDPLRKGSPKEAQAAVPIPSLGQQNNLPHRVKLKPMKRKRNILREYSRNLLEVSR
DFFLEGSRNLSLERSKDYVPNITSSFSFEVSEKQCYRQSIPTQENEDLSHNLCYELQLLF
TRQVIQWSLKPTAGSTSNTITSDLLLGILRRRRGASGSSSRGRLRKLVA
Download sequence
Identical sequences A9RRE8
jgi|Phypa1_1|69495|fgenesh1_pg.scaffold_23000097 XP_001756563.1.60028 3218.JGI69495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]