SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI69542 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI69542
Domain Number - Region: 219-261
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0233
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI69542
Sequence length 848
Comment (Physcomitrella patens)
Sequence
MELNRVSEKKMVELFGLAMIPEIRDHITSIMDRYGNSWEVFSHALKDEYFLEDADLVTKK
LFLGWIERPNKNLQATELLREFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQGKLELL
LEDKEEDEGLTTKWKNVEDAVGLLAKRERRKDRSNIPKTVEAPKAPICTTPPIMPTVQPS
TSLSKKADIGMEESIRGMRDLQIKLARLQENTSTNNLKNVSKQGYVQRCIWCDDASHTRK
DCNEFNNIIRQGIICRKDGKIALKDRKDLLQTNFGKGGMRALVQDYLKEHEIAARESASY
GARVDDDLGGSTETSEFWASTISIIQEGKLPREALLRTAATIRGTIGWEDHVESLSVHAY
IAKSQHEALMEEKRRGNFDDIREGNSSKRQTQGDKAREAASQELLVKDISASLEEKTRET
KDKGKSIAYKLLSDIEAATNLKGILEERILNVKVKFTLKEVLEIAKKEFHDVIIDSIKRK
RQLMGETRMSHAIDARIYKDEEEVDIGYKQPRNEKNGYNQRVCFEDYSDKEMETLSHYTR
KHWTRATTEVLVKVGDIEEPIVAFDHGSEINLMSKDLYKKQKWPIDMEHGWAIRAANNTW
GELYGACPDVKIRIGDVATEQHFFVQDTTSYPLILGQPYITASRMETKVLDNSSAYARRD
YGGTKEEVLSRDEGAFDASFIGILENGNIMYKKVDDFKRKERKRLYNIKRKLRKLGTLQD
DERIFGVYEENGLEDSLELITSIGLGDNDKIVEIHSREVYTILESFQAPKVTVETRYKTT
DKKVKPVAKLLSEDSKEQMGEASKEASLRDLISIGHLFTKDTFEELKIGSDGFLLPEEIT
CFKKMLAK
Download sequence
Identical sequences A9RR58
jgi|Phypa1_1|69542|fgenesh1_pg.scaffold_23000144 XP_001756586.1.60028 3218.JGI69542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]