SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI69625 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI69625
Domain Number - Region: 559-652
Classification Level Classification E-value
Superfamily Acid proteases 0.00141
Family Retroviral protease (retropepsin) 0.058
Further Details:      
 
Domain Number - Region: 246-284
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0262
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI69625
Sequence length 899
Comment (Physcomitrella patens)
Sequence
MGWGKKDFDKQSKHIRRDLRNSKAMIERKLWQPKYCKQWSIKLINLMGGIFQVSEKKMVA
QFGLATIPEIRDHITSITDRYGNSWEDFLHALKDEYFLEDADRVTKKLFLGWIKRPNKNL
QAIELLREFERQYSQLSKVEKLTLEPNKVELFLQAADGELQEKLEPLFEEKEEDEGLTMK
SNIPKTVQAPKALVRTTPLTMPTVQPSTSLSKKADMGMEEIIRGMRDLQIKLARLEENTS
INNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDGKIALKDREDLLQTN
FGKGGMRALVQDYLKEHKKAAQESASYGARVDDDLGGSTETSEFWASAISTMQEEKLPRE
VLLRIAATIRGATGWKDPVESLSVHAYIAKGQHEALMEEKRRGNFDDTREGNSFKRQIRG
DKAREAASQELPVKDTLASLEEKTTETKDKGKSIAYKLLSDIEAARNLKGVLEERILNAK
VEFTLKEVLEIVKKEFHDVIIDSIKRKRDEEEVDIGYKQPTNEKNGYNQRVRFEDSSDKE
IETLSHYTRKHWARATTEVLVKVGNIEEPIVALVDHGSEINLMSKDLYKKQKWPIDMEHG
WTIRAANNTRGELYGACPDVKIRIGDVATEQHFFVQDTMSYPLILGQPYITATRMETKVL
DDGSAYARIWSEDGKKAVQFLTVSPNHERNRDRLREKPLPKIVEGFKDFGKIGTLQDDER
ILGVYEENGLEDSLALITSIELGNNDKIVDIHSREIYTMLESFQAPEVIVESRYKTADKK
VKPVAGPLPEDSKEQMGEPTKEASLRDPMSIGHQFTKQTFEELKISSDGSLLPEEITCFK
KMLAKQGRSFAFESHEIECVDPNIITPMVIFTVPHQEDESDLDNEGDEDELDKDVEDIF
Download sequence
Identical sequences A9RRW4
jgi|Phypa1_1|69625|fgenesh1_pg.scaffold_24000017 3218.JGI69625 XP_001756725.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]