SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI69800 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI69800
Domain Number - Region: 368-390
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0173
Family Retrovirus zinc finger-like domains 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI69800
Sequence length 401
Comment (Physcomitrella patens)
Sequence
MQFNYEKIEVLLRSSAKLTRRTNLIQLRKHLSLTTGLLSNMRPELVGRLNVVPITRLRFR
FNLFRPLCRSGNVLSLFIFQHSKTDKLLEYWRISILPSTAKRSTRSREGKHKIKIKILKD
LWEEFLVGILLKDKQQQSNDRKEALATKALQAVVNKIDQFDGRNISRYLRCYVREMDLNR
VFEKIMLELFGLAMMPKIRDHITSITDRYGNSWEPNKNLQATELLRKFERQYSQLSKVEK
LTLKPNKVDLFLQAADEELQEKLELLLEDKEEDEGLITKWKNVEDAVGLLTKRERRKDRS
NIPKTIQAPKAPIRTTPPTMPTVQPSTSLSKKADMRMEEIIRGMRDLQIKLARLEENTST
NNSKNVSKQGYVQRCIRCDDASHTWKDCNEFNNMIRQGIIC
Download sequence
Identical sequences A9RS19
3218.JGI69800 XP_001756992.1.60028 jgi|Phypa1_1|69800|fgenesh1_pg.scaffold_25000030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]