SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI69918 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI69918
Domain Number - Region: 268-306
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0173
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 35-99
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0981
Family Insect pheromone/odorant-binding proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI69918
Sequence length 624
Comment (Physcomitrella patens)
Sequence
MYMDPSIASLFQAFSLSIQQQQSNDRKEALATKALQAVVNKIDQFDGRNISRYLRCYVRE
MELNRVSEKKMVALFGLATIPEIRDHITSITDRCGNSWEDFSHALKDEYFLEDADRVTKK
LFLGWIERPNKNLQYFQLSKVEKLTLEPNKVDLFLQAADGELQEKLEPLLEDKEEDEGLT
TKWKNVEDTVELLTKKERRKDRSNISKTVQAPKAPVRTTPQTMPTVQPSTSLSKKADMGM
EEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQ
GIICWKDGKIALKDREDLLQTNFGKGGMRALVQDYLKEHETVVRESASYGARVDDEIGGS
TETSEFWASAVSTMQEGKLPREALLRTAATIRGRTGWEDPVESLSVHAYIAKSQHEALME
EKRRGNFDDTREGNSFKRQTRGDKAREAASQELPLLSDIEAATNLKGVLEEHILNAKVEF
TFKEVLGIAKKEFHDVIIDSIKRKRQLMSETGMSHAIDVRICRDEEEVDIGYKQPTNEKN
GYNQRVRFEDSSDKEMETLSHYTRKHWARATTEVLVKVGNIEEPIVALVDHGSEINLMSK
DLYKKQKWPIDMEHGWAIRAANNT
Download sequence
Identical sequences A9RSC2
3218.JGI69918 XP_001756941.1.60028 jgi|Phypa1_1|69918|fgenesh1_pg.scaffold_25000148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]