SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI70044 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI70044
Domain Number - Region: 143-190
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000136
Family Retrovirus zinc finger-like domains 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI70044
Sequence length 267
Comment (Physcomitrella patens)
Sequence
MFVKEAQPVTISASLDRAKVWEECHYDQFLTACATMIPVQSNYQYPALNGSVGSYPQMIE
TVAQSSANTQGPVNVTPLQALPPQVTTAYAPYFPYQIHESTLAEKQIISASKDSNEALLL
NLTKKMEEMAINMAKDKEKRQKPTNSRTNVWCSNYQGHGHLVTECPSPSQVLGKCTFCGG
KHLTANCWNLQRQQQFSNPTMIPPTPWDVNQVQTGNTFGWHGNRSNRQNRAVNHFQNSTY
SEGGGDFEWTQEGPNYGIRRRGGCKDM
Download sequence
Identical sequences A9RSP1
3218.JGI70044 jgi|Phypa1_1|70044|fgenesh1_pg.scaffold_26000045 XP_001757106.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]