SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI70049 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI70049
Domain Number - Region: 663-761
Classification Level Classification E-value
Superfamily Acid proteases 0.00225
Family Retroviral protease (retropepsin) 0.048
Further Details:      
 
Domain Number - Region: 463-502
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0314
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI70049
Sequence length 1005
Comment (Physcomitrella patens)
Sequence
MDSQEIDTMPVRVSQPSSSRRRPRDEELHIKPAYDGQLEGVFAGQFHNEDTQVHAWSKVE
GVGHYRWLQGSMNHLPREQQLEFIAEIMRQIFIFLRCYLKYWEQRPTPVQILSGQVQLPR
YSQPGHTEMLRSIPITGVSRKGKDQFTRRGTLFSVNGFLKVKTEEKALTARANFGSKLDG
FLGGVFGGDSSKGQGMHMDPSIASLFQAFSLSMKQHQSNDRKEALATKALQAVVNKIDQF
DGRNISRYLRCYVREMELNRVFEKKMVALFGLATIPEIRDHIISITDCYGNSWEDFSHAL
KDKYFLEDADRVTKKLFLGWIERPNKNLQYSQLSKVEKLTLEPNKVDLFLQAADGELQGK
LELLLEDKEEDEGLTTKWKDVEDVVGLLTKRERRKDRSNIPKTVQAPKAPVCKIPPTMPT
VQPSTSLSKKADMGMEKIIRGMRELQIKLARLEENISINNSKNVSKQGYVQRCIWCDDAS
HTRKDCNEFNNMIQQGIICWKDGKIALKNREDLLQTNFGKGGKRALVQDYLKEHETATRE
SASYGARVDDEIGGSTETRVLEERILNAKVEFTLKEVLRITKKEFHDVIIDSIKRKRQLM
GEVGMSHAIDARIYKDEEEVDIGYKQPTNERNGYNQRVRFEDSSDKEMETLSHYTRKHWA
RATIEVLVKVGDIEEPIVALVDHGSKINLMSKDLYKKQKWPIDMEHGWAIQAANNTRGEL
YGACPDVKIWIGDVATEQHFFVQDTTSYLLILGQPYITATRMETKVLDDGSAYARRDYGG
TKEEVLSRDEGAFDASFIGILENGNIMYKKVDDFKRKERKRLYDIEGQLRKLGTLQDDER
ILGVYEENGMEDSLELITSIELGDNDKIVEIHSREVYTVLESFQAPEVTVETRYKTADKK
VKPVVGPLPEDSKEQMGEASKEASLRDPMSIGHQFTKETFEELKIGSDGSLLPEEITCFK
KMLAKQEMNMEDLNEGIEIPQQEDESDLDIEGDEDELDKDVEDIF
Download sequence
Identical sequences A9RSP6
3218.JGI70049 jgi|Phypa1_1|70049|fgenesh1_pg.scaffold_26000050 XP_001757109.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]