SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI70273 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI70273
Domain Number - Region: 242-280
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0262
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI70273
Sequence length 695
Comment (Physcomitrella patens)
Sequence
MVNKIDQFDGRNISRYLRCYVREMELNWVSEKKMVELFGHATILEIRDHITSILDRYGNS
WEVFSHALKDEYFLKDADRITKKLFLEWIERPNKNLQATELLREFERQYSQLSKVEKLTL
EPNKVDLFLQATDGKLQGKLELLLEDKEEDEGLTTKWKKVEDAVGLLTKRERKKDRSNIP
KTIQAPKAPVCTTPPTMPTVQPSTSLSKKADMGMEEIIRGMRDLQIKLARLEENTSTKKL
KNISKQGYVQRCIWCDDASHARKDCNEFNNMIRQGIICWKDGKIALKDRKDLLQTNFGKR
GMRALVQDYLKVHETAARESASYGARVDDDLGGSTEISEFWASAISTMQEGKLPRKVLLR
TTAIIQGTIGWKDPVEFLSIHAYIAKSQHEALMEEKRRGNFDDTREGNSSKRETKVKSKS
IIYKLLSDIEAATNLKGVLEEHILNAKVEFTLKEVLEIAKKEFHDVIIDIIKRKRQLMGE
TGMSHAIDARIYKDEEEVDIDYKQPTNEKNGYNQRVCFEDYSDKKMETLSHYTRKHWTRA
TTKKQKWPIDMEHRWAIRAANNTWGELYGACPDVKIRIEDVTTEQHFFVQDTTSYPLILG
QPYITAIRMETKVLDDGSAYVRGHPGLTTSLLANMRPELVGRLNVVPITGLQFRFRLFHS
LCRSGNVLSIKRSLKGKNGGESSDGGVNSGSKTED
Download sequence
Identical sequences A9RTA7
jgi|Phypa1_1|70273|fgenesh1_pg.scaffold_27000102 XP_001757395.1.60028 3218.JGI70273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]