SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI70430 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI70430
Domain Number 1 Region: 198-237
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000227
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI70430
Sequence length 448
Comment (Physcomitrella patens)
Sequence
MTQSDSVRMFDGSNFLKWSTQLQFILKRRGLWKYVAPKAECAASKSESTTTDESTAEKAA
RRAIETKRLAANYIDASDSAFDFDKDSQETRIIASAMGMEIMNYIKDCTTARDAWSTLKE
NFDQTGLERTVSLLVELIKIKHPSQESMQAYLVKIKTVANKLNLEDSVHINERMHIEIFN
AEVSTGKTSKATTALSATTNSRKGGKPKGKKPSRNVKCHPCNLTGHIKKDCYAKKKNDGS
PIDTHPHEIGVELGDETIIQAAVIGKIDPKTKHSVRSLTDILYVKDLKKNHFAVSKASGK
GVQITFSVEKVTVRTHNGRSLIEGTEKSRLGLYNLTARKTDSQHWPELFAVAGNSTKLLK
SAWGRIYIAQPHATNWSVFWVMEKLEGPPMSQHCLFALRDAHPLSIILLKNCVIPPGSDL
DTIVNYSFVCKSLGQYLRPRSWMMAIGL
Download sequence
Identical sequences A9RTQ4
XP_001757470.1.60028 jgi|Phypa1_1|70430|fgenesh1_pg.scaffold_28000035 3218.JGI70430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]