SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI70539 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI70539
Domain Number - Region: 607-690
Classification Level Classification E-value
Superfamily Acid proteases 0.0319
Family Retroviral protease (retropepsin) 0.078
Further Details:      
 
Domain Number - Region: 269-298
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0471
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI70539
Sequence length 874
Comment (Physcomitrella patens)
Sequence
MTNSSTNTEWPGSVTPLQSAGTYRLGQKGLRQAVEGHPYRFTVYSCSCLYSNSQKLINCL
SIGESPYYFLQPHVWIFGRSFWWRFFKKTKYAHGKDEYFLKDVDRVTKKLFLEWIEWPNK
NLQATELLREFKRQYSQLSKVEKLTLEPNKVDLFLQAADGELQGKLELLLEDKEEDEGLT
TKWKNIEDAMGLLTKKERRKDRSNIPKTVQAPKAPVRTTPPTMPTVQPSTSLSKKADIGI
EEIIRGIRDLQIKLARLEENTSINNSKNVSKQVYVQRCIWCDDASHTRKDCNEFNNMIRQ
GIICWKDEKIALKDRDDLLQTNFGKGGMRALVQDYLKEHEIAARESTSYGARIDDEIGGS
METSEFWASAVSTMQEGKLPREAYLKTVATIRGRTGWEDPVESLSVHAYIAKSQHEALME
EKRRGNFDGTREENSSKRQTRGDKAREAASQELPVKDALASLGEKTKETKDKGKSIAYKL
LSDIEAATNLKGVLEERILNAKVEFTLKEVLGIAKKEFHDVIIDSIKGKRQLMGETRMSH
AIDARIYKDEEKVDIGYKQPTNEKNVYNQRVRFEDSSDKKMETLSHYTRKHWTRATTEVL
VKLGDIDEPIFALVDDGSKINFMSKDLYKKQKWPIDMEHGWAIRAANNTWGELYGAYPDV
KIRIGDVATEQHFFVQDTTSYPLILGQPYIIATRMEIKVLDDGSAYARVEGETIIELGDN
DKIVEIHSREVYTIFESFQAPEVTVETRYKTADKKVKPVVRPLPEDSKEQMEEASKEASL
RDPMSIGHQFTKETFEELKIGSDGSLLPEEITCFKKMLAKQGRSFAFESHEIGCVDPNII
TPMVIFTVPHQEDESDLNNEGDEDKLDKDVEDIF
Download sequence
Identical sequences A9RU00
jgi|Phypa1_1|70539|fgenesh1_pg.scaffold_28000144 XP_001757626.1.60028 3218.JGI70539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]