SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI70669 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI70669
Domain Number - Region: 272-310
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0241
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 574-666
Classification Level Classification E-value
Superfamily Acid proteases 0.03
Family Retroviral protease (retropepsin) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI70669
Sequence length 729
Comment (Physcomitrella patens)
Sequence
MENENKNFEGFLGGVSGVDSSKGQGMHMDPSIASMFQAFSLSMQQQQSNDRKEALATKTL
QAVVNKIDQFDGRNISRDHITLITDHYENSWEVFSHALKDEYFLEDADRVTKKLFLEWIE
RPNKNLQATELLREFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQGKLELLLEDKEED
EGLTTKWKNVEDAVGLLTKRERRKDRSNIPKIVQAPKAPVRTTPPTMPTVQPSTSLSKKA
DMEMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNN
TIWQGIICWKDGKIALKDREDLLQTNFGKGGMKALVQDYLKEHETAARESTSYGARVDDD
LGGSTETSEFWASAISTMQEGKLPRKALLRTAATIRDATGWEDPVESLSIHAYIAKSQHE
ALMEEKRRGNFDDTREGNSSKRETKDKGKSFAYKLLSDIEAATNLKGVLEERILNAKVEF
TLKEVLGIAKKEFHDVIIDSIKRKRQLMGETQMSHTIDVRIYKDEEEVDIGYKQPTNEKN
GYNQRVHFEDSSDKEMRTLSHYIQKHWAKATTEILVKVGDIEEPIVALVDHGSEMNLMSK
DLYKKQKWPIDMEHGWTIRAANNTRGELYGACPNVKIRIGDVATEQHFFVQDTTSYPLML
GQPYITATWMETKVLDDGSAYARVRSEDGRKAVQFLTVPPNHERNQDRLREKPLPKIVEG
FKDFGEVPL
Download sequence
Identical sequences A9RUC3
jgi|Phypa1_1|70669|fgenesh1_pg.scaffold_29000036 XP_001757688.1.60028 3218.JGI70669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]