SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI70846 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI70846
Domain Number - Region: 271-313
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000321
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 
Domain Number - Region: 6-30
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0647
Family CRAL/TRIO domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI70846
Sequence length 586
Comment (Physcomitrella patens)
Sequence
MCLDNGNSDDTLESYVPLEKLPRALGGNFVNIPVEILRPLTEREGGIEVFGTPLGNFPVG
GTAETSNRGSADWHELVANKGNYIVFQNPTFSPASQPIKLFVGNNSKARTAESSVIRVRK
SRDYFKTNFRGTENSMAAGGPAVPIAVQMGTLGDHTTSVIPLPTFRGLPGGYQMTNWNDA
SESYPGRSDYGTIPQGIVNAVPLQAVLPSSLQPYVPYSAYQKPIPMKELTNELVSRNPNE
SLLLTLTKKMDELAVNLAKDKEKRHKPTNMRLNVWCSNCKGQGHLVTECSSPPQMMVQCT
FCGGKHTTANCWNLRKQQQVGQQTMSQPTSWDVNQMQTSQPAEDTGPVQWDSPVHRVEVV
NAVLTRGQQKDKNPIQDLDDPIEVTTVAPSKRRTEPISVLGRIPILSPQQDEEPTSVSRA
NFLETSRSIPNDHVPIPAQSNISSYPLKEPLVVEESTKRKELLPNKRFIMSREKVKRASE
KEEEGRRIIYNQSKLEVEKMKQQLELNQTKMATLEQEKKTISDQFRVKTKEMQGEINTLK
EVTKKLEEELVSVRRPQGSIEGSIGELEQKVKQQQYQLEAKDTRIL
Download sequence
Identical sequences A9RUU5
XP_001757976.1.60028 jgi|Phypa1_1|70846|fgenesh1_pg.scaffold_30000006 3218.JGI70846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]