SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI70852 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI70852
Domain Number - Region: 539-633
Classification Level Classification E-value
Superfamily Acid proteases 0.009
Family Retroviral protease (retropepsin) 0.063
Further Details:      
 
Domain Number - Region: 219-261
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0228
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI70852
Sequence length 763
Comment (Physcomitrella patens)
Sequence
MELNWVSEKKMVALFGLATIPEIRDHITSITDRYGNSWEVFSHALKDEYFLEDADRVTKK
LFLGWIERPNKNLQATELLREFERQYSQMSKVEKLTLEPNKVDLFLQAADGELQGKLELL
LEDKEEDEGLTTKWKNVEDAVGLLTKRERRKDRSNIQKTVQAPKAPVRTTPPTMPTVQPS
TSLSKKADMGMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRK
DCNEFNNMIRQGIICRKDGKIALKNRKDLLQTNFGKGGMRALVQDYLKEHQTVARESASY
GARVDDEIGGSMETSEFWASAVSTMQKGKLPREALLRTAATIQVHAYIAKSQHEALMEEK
RRGNFDDTREGNSFKRQTRGDKAREAASQELPVKGTSASFGEKTTETKDKGKSIAYKLLS
DIEAATNLKGVLEEHILNAKVEFTLKEVLEITKKEFHDVIIDSIKRKRQLMGETGMSHAI
DARIYRDEEEVGIGYKQPTNEKNGYNQRVRFEDSSDKEMETLSHYTRKHWARTTTEILVK
VGDIEEPIVTLVDHGSEINLMSKDLYKKQKWPIDMEHGWAIRAANNTRGELYGACPDVKI
RIGDVATEQQFFVQDTTSYPLILGQPYITATRMEIKVLDDGSAYARVQSEDGRKAVQFLT
VPPNHERNRDRLREKPLPKIVEGFKDFGKILGIYEENGLEDSLELITSIGLGDNDKIVEI
HSREVYTILESFQAPEVTIETRYKTVDKKVKPIAGRLPKDSKE
Download sequence
Identical sequences A9RUV0
jgi|Phypa1_1|70852|fgenesh1_pg.scaffold_30000012 XP_001757880.1.60028 3218.JGI70852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]