SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI70966 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI70966
Domain Number - Region: 352-397
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000181
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI70966
Sequence length 970
Comment (Physcomitrella patens)
Sequence
MVNKNESIASRKTNQLRERQGRAQGRNLHREEQERNLKRKHRQNWIKPWLQAYRRIRTYQ
ESDILLILQSYVSLEKLPRALAGNFVNIPVEILRPLTEREGGVEVFGTPLDNFPIGGTAE
MSNRGSADWHELVANKSNYIVFQNSTFSRASQATKLFAKNNSKARTAESSVIRVRESRDY
FKINFRGTKNSMAVGGPAVPIAVQMGTLSDRTTSVTPLPTFRGLSASLERAKVWEECHYD
QHLTVGATMIPSQGGYQMTNWNDASESYPGRSDYGTIPQGIVNAVPLQAALPSSSQPYVP
YSAYQKPIPTRELTNELISRDPNESLLLTLTKKMDELAVNLAKDKEKRHKPTNMRPNVWC
SNCKGQGHLVTECSSPPQMMVLCTFCGGKHTTANCWNLRKQQQVGQQTMSQPTSWDVNQM
QTSQPAEDKGPVQRDSPVHRVEVVNAVLTRGQQKGKNPIHDLDDPIEVTTIASSMRRTEL
IPVLDRIPILEPQQDEEPNSVLHANFSGTLRSIPNDPIPIPAQPNISSILSRIVEAEFVS
GEFTANHSISANTQSFIMSREKVKRASEKEEEGRRVRSRSNMDELSLYILTNMEPMRLEI
CWNATRQKDFKSTQLYSFLRAGDNLPSIDVELLEEYLTNYDPEDGSSIVKGRTLGIDENT
LHKALQLPIGELAVGAEEASDFNPGSYFKGSMTSLERNQRWRTADALTPELMEWMRFIQK
RLGLNRHMTYMAKRLLYATIGSFEGMVFNWTAYVATRIHAELSYKRRSGRIATLLCSNYI
QSAIVYELSQLLPEKGKTIAAPVLPKPRSNLLALPWGPGETSQQAGEPISVRERGPMVQR
DNRPVDIQHRTLEENSVKERFLVQLSQLQEMANELVDHTNFKQQLVAYKREMAEQRQKLL
EQDRTKMATLEQEKKTMNDQFRVKTKEMQGEINTLKEVAKKLEEELVSVRWLQGSIEGSI
GELEQKVKQQ
Download sequence
Identical sequences A9RV58
jgi|Phypa1_1|70966|fgenesh1_pg.scaffold_30000126 3218.JGI70966 XP_001757930.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]