SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI71484 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI71484
Domain Number - Region: 304-344
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0228
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 415-509
Classification Level Classification E-value
Superfamily Acid proteases 0.0253
Family Retroviral protease (retropepsin) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI71484
Sequence length 742
Comment (Physcomitrella patens)
Sequence
MENENKNFEGFFGGVSRGESSKGQGMYMDPSIASLFQAFSLSMLQQQSNDRKEALATKAL
QAVVNKIDQFDGRNISRYFRCYVREMELNRVSEKKMVALFGLATLPEIRDHITSIKDRYG
NSWEVFSHALKDEYFLEVADRVTKKLFPEWIEWPNKNLQATELLRKFERQYSQLSKVEKL
TLEPNKVDLFLQAADGELQEKLEPLLEDKEEDEGLTTKWKNVEDALELLTKKERRKDRSN
IPKTVQASKAPVRTTPPTMPTVQPLTSLSKKADMGMEEIIRGMRDLQIKLARLEENTSTN
NSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWKDGKIAVKNREDLLQTNFG
KGRMRALVQDYLKEHETVARESASYASTFQDSSDKEMETLSHYTRKHWARATTEVLVKVG
DIDEPIVALVDHGSEINLMSKDLYKKQKWLIHMEHGWAIRAANNTWGELYGACPDVKIWI
RDVATEQHIFVQDTTSYPLILGQPYITATQIERKVLDDGSAYARIRSEDGRKAVQFLTVP
PNHERNQDRLREKPLPKIVEGFKDFGEEVLSQDEGAFDASFIGILENGNIMYKKVDDFKR
KERKRLYNIEGQLHKIGALQDDERILGVYEENGLEDSLELITSIGLGDNDKIVEIHSREV
YTMLESFQVPEVTVETRYKTADKKVKPVAGPLLEDSKEQMGEASKEASLRDPMSIGHQFT
EETFEELKIGSDGSLLLSRTYI
Download sequence
Identical sequences A9RWK2
XP_001758489.1.60028 3218.JGI71484 jgi|Phypa1_1|71484|fgenesh1_pg.scaffold_32000196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]