SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI71773 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI71773
Domain Number 1 Region: 157-189
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000314
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI71773
Sequence length 214
Comment (Physcomitrella patens)
Sequence
MAAGVPKVPIAIQMGAVGDQTTNVAPLPTFNDWPGSDPDYHVSQFLTVYVANNVGATMIP
SSGSQQIQLENVSMDNYPQMAASNVKNVMLQKLINATPLQAIAPITMTPYFTSPIYQQSE
LFTNTIIKDPNKALLLNLTKKMEELVVNLAKDKEKQHKPCNTRSDVWYNNCKEQGHFDTE
CPSPRKTGVQCIFYGGKHPTQNYWHLQRQQQFNN
Download sequence
Identical sequences A9RXB8
XP_001758734.1.60028 jgi|Phypa1_1|71773|fgenesh1_pg.scaffold_34000038 3218.JGI71773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]