SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI72293 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI72293
Domain Number - Region: 16-52
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00126
Family Retrovirus zinc finger-like domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI72293
Sequence length 364
Comment (Physcomitrella patens)
Sequence
MDELAMNLAKDKEKSNCKEQGHLVTKCPSRPQMTVQCTFCGGKHITTNCWNLQKQQQLSN
QIMTQPTSRDVNQVVNAVLTRGQQKDKNLIQDEDERIAGEQVASSMGLNKPISVLGRIPI
LRPQQTDELNSVPRTNLSGPSNPSPVTGSISSMRPNSVAQPNEISIIEASVPFQAVSIST
QFQKTSYPLKDPFKGENSKKISTAVPIPSPGWKNILPHGVESKPMKRKRGQLVMEREKTE
LLAQEKLVLSDQYKYETEWLRAEIEALNTEVTRLVEDLVNIGQAQVLTLSVLEVPEERSH
FQRQLELRDAQILKLEAQVHELGEYNEDLSAQLRQEPMEGLEKDENLQLEPESVEPITDI
VAID
Download sequence
Identical sequences A9RYX7
jgi|Phypa1_1|72293|fgenesh1_pg.scaffold_36000092 XP_001759291.1.60028 3218.JGI72293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]