SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI72323 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI72323
Domain Number - Region: 209-248
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00565
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI72323
Sequence length 284
Comment (Physcomitrella patens)
Sequence
MDTRFETPGAFSSRKACNTTTDCYGNSWEVFSHALKDEYFLEDTDRITKKLFLEWIERPN
KNLQATELLREFERQYSQLSKVEKLTFEPNKVDLFLQAADGELQGKLKLLLQDKEEDEGL
TTKWKNVEDAVGLLTKRERRKDRRNILKTIQAPKAPVRTTPPTMPTVQPSTFLSKKADMG
MEEIIRGMRDLQIKLARLEENTSTNNSKNISKEGYIQRCIWCDDASHTRKDCNEFNNMIR
QGIICWKDGKIALKNTEDLLQTNFGKGGMRALVQDYLKEHKTAA
Download sequence
Identical sequences A9RZ02
3218.JGI72323 XP_001759304.1.60028 jgi|Phypa1_1|72323|fgenesh1_pg.scaffold_36000122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]